SSEARCH searches a sequence database using the Smith-Waterman algorithm version 2.0u54, July. 1996 Please cite: T. F. Smith and M. S. Waterman, (1981) J. Mol. Biol. 147:195-197; W.R. Pearson (1991) Genomics 11:635-650 >MMN10.10 (Universal genetic code) : 150 aa vs library searching ath2b library 150 residues in 1 sequences The best scores are: s-w ATH2B, 150 bases, 1E0B checksum. (150) 919 >>ATH2B, 150 bases, 1E0B checksum. (150 aa) Smith-Waterman score: 919; 97.333% identity in 150 aa overlap 10 20 30 40 50 60 MMN10. MAPKAEKKPAEKKPASEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV :::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::: ATH2B, MAPRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV 10 20 30 40 50 60 70 80 90 100 110 120 MMN10. ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREI ::::::::::::::::::::::::::::::::::::::::.:.::::::::::::::::: ATH2B, ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREI 70 80 90 100 110 120 130 140 150 MMN10. QTAVRLVLPGELAKHAVSEGTKAVTKFTSS :::::::::::::::::::::::::::::: ATH2B, QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 130 140 150 Library scan: 0:00:00 total CPU time: 0:00:00