SSEARCH searches a sequence database using the Smith-Waterman algorithm version 2.0u54, July. 1996 Please cite: T. F. Smith and M. S. Waterman, (1981) J. Mol. Biol. 147:195-197; W.R. Pearson (1991) Genomics 11:635-650 >K9D7.P1 (Universal genetic code) : 61 aa vs library searching gi:603890 library 79 residues in 1 sequences The best scores are: s-w gi|603890 ( 79) 202 >>gi|603890 (79 aa) Smith-Waterman score: 202; 49.180% identity in 61 aa overlap 10 20 30 40 K9D7.P KSSWPELVGRRGEEVKEIIDRENTKVTAKIISENAVVLAVVICD :..:::: : ::::. .. :: .::: :. :...: . :: gi|603 KMEACARRVSHCRDVGKNTWPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDERCD 10 20 30 40 50 60 50 60 K9D7.P RVYVRVNDQGIVTRTPI :: : :...:::::.:. gi|603 RVRVWVDENGIVTRVPVIG 70 Library scan: 0:00:00 total CPU time: 0:00:00