SSEARCH searches a sequence database using the Smith-Waterman algorithm version 2.0u54, July. 1996 Please cite: T. F. Smith and M. S. Waterman, (1981) J. Mol. Biol. 147:195-197; W.R. Pearson (1991) Genomics 11:635-650 >K21C13.16 (Universal genetic code) : 73 aa vs library searching g02284 library 70 residues in 1 sequences The best scores are: s-w G02284, 70 bases, 22B8 checksum. ( 70) 228 >>G02284, 70 bases, 22B8 checksum. (70 aa) Smith-Waterman score: 228; 50.000% identity in 74 aa overlap 10 20 30 40 50 K21C13 MAAEPKAAVEVVKVDLFEDDDEFEEFEINEDW--LEKEEVKEVSLQWEDDWDDDDVSDDF :. : : :. . :.:.::::::: ::: :...: .: :::.::::.: ::: G02284 MS-EKKQPVD---LGLLEEDDEFEEFPA-EDWAGLDEDEDAHV---WEDNWDDDNVEDDF 10 20 30 40 50 60 70 K21C13 SRQLKKELENASEKK : ::. :::. . : G02284 SNQLRAELEKHGYKMETS 60 70 Library scan: 0:00:00 total CPU time: 0:00:00