information on T3E15    (99685..99804)

Direction: +

Frame: 1

ORF

    99610..100059  (Met: 99652 99703 99730)
NPLSSNGKTGTGLVMSARKLRPYFQSHPIVVMTSQPIRTIMHSPTQSGRVAKWAIELSEY
DIEYRTSTSLKAQVLADFVIELPLADLDGTNSNKKWLLHVDGSSNQQGSGVGIQLTSPTG
EVSEQSFQLGLYASNNESEYEALIAGIKIA

GenBank annotation

    None

BLASTX cluster

    93864..101553    cluster 33    75 hits for protein gene

BLASTN cluster

    None

GENSCAN

    93864..101613    gene model 26
    77064..78259    gene model 21
    Suboptimal exon

        99624..100025    Intr    Phase: 2    Score: 0.151
        99723..100025    Intr    Phase: 2    Score: 0.179
        99730..100025    Init    Phase: 0    Score: 0.124

Grail


    Shadow exon

        99703..100062    exon    Phase: 0    Score: 96

Exon-Intron boundary candidatates

Acceptor
99738 [0.002] (2) 99752 [0.003] (1) 99797 [0.002] (1) 99810 [0.001] (2)
99829 [0.080] (0) 99931 [0.016] (0)
Donor
99653 [0.128] (2) 99751 [0.011] (1) 99781 [0.017] (1) 99972 [0.099] (0)
100025 [0.003] (2)

[help]


Entrance