information on T3E15    (99089..99175)

Direction: +

Frame: 2

ORF

    98957..99193  (Met: 98975 99029 99077 99155)
AYCYKVMPFGLKNAGATYQRLVNRMFADQLGKTIEVYIDDMLVKSAREKEHVQQLRECFK
ILNKFEMKLNPEKCSFRVP

GenBank annotation

    None

BLASTX cluster

    93864..101553    cluster 33    75 hits for protein gene

BLASTN cluster

    None

GENSCAN

    93864..101613    gene model 26

Grail


    Shadow exon

        98975..99047    exon    Phase: 0    Score: 21

Exon-Intron boundary candidatates

Acceptor
99028 [0.035] (2) 99048 [0.005] (1) 99187 [0.011] (2)
Donor
98971 [0.016] (0) 99047 [0.196] (1) 99087 [0.029] (2)

[help]


Entrance