information on T3E15    (97742..97810)

Direction: +

Frame: 2

ORF

    97700..98332  (Met: 98048 98216 98219)
KRQLRTRVQKLDLGKYCKYHKKRGHSTEECRAVKKLIAAGGKTKKGSNPKVETPPPDEQE
EEQTPKQKKQERTPEGSDSPPPARRERIDLVFAKLDLGGRTGRSVTTPPPAPHKKNMRFP
LRLSKFCRSATEHLSPKRIDFIIGGSQLCNDSINSIKTHQRKADSYTKGKSPMMGPDHQI
TFWESETTDLDKPYDDALVIRIDVGNYELSV

GenBank annotation

    None

BLASTX cluster

    93864..101553    cluster 33    75 hits for protein gene

BLASTN cluster

    None

GENSCAN

    93864..101613    gene model 26
    Suboptimal exon

        97815..98007    Intr    Phase: 1    Score: 0.106
        97851..98007    Intr    Phase: 1    Score: 0.334

Grail


    Shadow exon

        98083..98335    exon    Phase: 2    Score: 70

Exon-Intron boundary candidatates

Acceptor
97700 [0.002] (0) 97703 [0.001] (0) 97815 [0.012] (1) 97836 [0.003] (1)
97877 [0.025] (0) 97910 [0.003] (0) 97992 [0.088] (1) 97999 [0.215] (2)
98004 [0.054] (1) 98008 [0.005] (2) 98083 [0.060] (2) 98180 [0.003] (0)
98190 [0.035] (1) 98205 [0.016] (1) 98313 [0.017] (1)
Donor
97820 [0.020] (1) 98007 [0.92N/0.268] (2) 98052 [0.021] (2) 98308 [0.81N/0.005] (0)

[help]


Entrance