information on T3E15    (43855..43974)

Direction: +

Frame: 1

ORF

    43624..44038  (Met: 43705 43768 43846 43906 43914)
SIYTPRVPYPRKRRSKKEIHAAKCTSIMEKILHSLPKDASETSSAPLNMYVKRLVDNGIS
LDEASLLTRDIGAIMLPKAQRVDIVEYICTITPD*H*SFQIQVASFLIAQFPQASSVALC
VIWDQVSTSCLSLLLRD

GenBank annotation

    None

BLASTX cluster

    33209..45210    cluster 12    56 hits for protein gene

BLASTN cluster

    None

GENSCAN

    43192..50804    gene model 15
    38669..37237    gene model 13
    Suboptimal exon

        43624..43905    Term    Phase: 0    Score: 0.120
        43656..43905    Term    Phase: 2    Score: 0.424
        43735..43905    Term    Phase: 0    Score: 0.125

Grail

    43803..43908    exon    Phase: 2    Score: 22

Exon-Intron boundary candidatates

Acceptor
43675 [0.001] (0) 43803 [0.004] (2) 43808 [0.005] (1) 43814 [0.006] (1)
43934 [0.005] (1)
Donor
43769 [0.114] (2) 43933 [0.817] (1)

[help]


Entrance