information on T3E15    (43156..42998)

Direction: -

Frame: 3

ORF

    43180..43019  (Met: 43132)
LEQGSRTNWTDTKNAFMNHLFDESVKEALRLQISSFTQAPAESLRAAWLRFRSY

GenBank annotation

    None

BLASTX cluster

    44376..41390    cluster 16    9 hits for protein gene

BLASTN cluster

    None

GENSCAN


    None

Grail


    None

Exon-Intron boundary candidatates

Acceptor
43025 [0.002] (2) 43041 [0.007] (1) 43066 [0.113] (0)
Donor
43026 [0.039] (2) 43171 [0.195] (1)

[help]


Entrance