information on T3E15    (41766..41668)

Direction: -

Frame: 1

ORF

    41766..41656  (Met: 41658)
KEPNDPLILGRSFLHTVGAIIDVRQGRIGLNVGDLTM

GenBank annotation

    None

BLASTX cluster

    44376..41390    cluster 16    9 hits for protein gene

BLASTN cluster

    None

GENSCAN

    42713..39087    gene model 14

Grail

    41766..41653    exon    Phase: 0    Score: 53

Exon-Intron boundary candidatates

Acceptor
41702 [0.010] (1) 41717 [0.017] (1) 41763 [0.077] (0) 41766 [0.005] (0)
Donor

[help]


Entrance