information on T3E15    (41979..41641)

Direction: -

Frame: 1

ORF

    42264..41929  (Met: 42201 42177 42120 42084 42081 41937)
IPFPKSPKKSRKALDDVRCKAMIDKLIVEMPLVEAIHLSPTIRRYVKTMVTKNLTKECSV
MMISEQGSDIIQERIPRKLLDPGTFVLSVTINHDFFPRALCDLGSSVNLMPR

GenBank annotation

    None

BLASTX cluster

    44376..41390    cluster 16    9 hits for protein gene

BLASTN cluster

    None

GENSCAN

    42713..39087    gene model 14
    33326..34918    gene model 12
    Suboptimal exon

        42167..41931    Intr    Phase: 1    Score: 0.123

Grail

    42120..41926    exon    Phase: 0    Score: 46

Exon-Intron boundary candidatates

Acceptor
42048 [0.027] (0) 42065 [0.001] (1) 42133 [0.005] (2) 42161 [0.001] (1)
42167 [0.001] (1)
Donor
42118 [0.012] (0) 42134 [1.00N/0.930] (2)

[help]


Entrance