information on T3E15    (40920..40789)

Direction: -

Frame: 1

ORF

    41115..40756  (Met: 41070 40920 40848)
RRLNPNPKEVVKKEIMKLLEAGIIYLISDSSWVSPVHVVPKKGGVTVVKNEKDELIPTET
ITGHRMCINYRKLNVATRKDHFPLRFIDQMLERLANHKYYCFLDGYSGFFRIPIHPRLLR

GenBank annotation

    None

BLASTX cluster

    41220..37494    cluster 13    16 hits for protein gene
    40786..40923    cluster 14    1 hits for protein gene
    40789..40923    cluster 15    1 hits for protein gene

BLASTN cluster

    None

GENSCAN

    42713..39087    gene model 14

Grail

    41070..40753    exon    Phase: 0    Score: 66

Exon-Intron boundary candidatates

Acceptor
40793 [0.005] (1) 40882 [0.002] (2) 40928 [0.066] (1) 40976 [0.002] (1)
41000 [0.033] (1) 41009 [0.005] (1) 41023 [0.171] (2) 41026 [0.003] (2)
41030 [0.340] (1) 41051 [0.011] (1)
Donor
40838 [0.94N/0.828] (2) 41020 [0.015] (0)

[help]


Entrance