information on T3E15    (39812..39648)

Direction: -

Frame: 2

ORF

    39875..39633  (Met: 39851 39671)
PEERFSSCMKLFKSIIFPRFGVPRIIISDGGKHFINKILAKLLLQYGVQHRVATPYHPQT
SGHVEVSNMQIKEILEKTVGK

GenBank annotation

    None

BLASTX cluster

    41220..37494    cluster 13    16 hits for protein gene

BLASTN cluster

    None

GENSCAN

    42713..39087    gene model 14
    Suboptimal exon

        39811..39785    Intr    Phase: 1    Score: 0.136

Grail


    None

Exon-Intron boundary candidatates

Acceptor
39665 [0.003] (0) 39733 [0.002] (1)
Donor
39681 [0.016] (0) 39785 [0.977] (1) 39854 [0.031] (1)

[help]


Entrance