information on T3E15    (33840..34274)

Direction: +

Frame: 3

ORF

    33825..34281  (Met: 34068 34106 34165 34239 34262)
ASKLVVSEDNLLCKLFPYSLAGEAASWLEQFKATSLKTWRSIKIAFLNNFCDDAKSKELR
NKFSTFTQGPAEALKAAWVRF*IPTRLPTSWFQ*YNFLVPSSEESVGDTRWL*AASNGNF
NTRYPADAIALIENIA*QQYQEC*LRGRN

GenBank annotation

    None

BLASTX cluster

    33209..45210    cluster 12    56 hits for protein gene

BLASTN cluster

    None

GENSCAN

    33326..34918    gene model 12
    Suboptimal exon

        33936..34058    Intr    Phase: 0    Score: 0.160

Grail

    34071..34182    exon    Phase: 0    Score: 39

Exon-Intron boundary candidatates

Acceptor
33847 [0.004] (1) 34071 [0.007] (0) 34106 [0.006] (2) 34136 [0.062] (2)
34158 [0.015] (0) 34219 [0.001] (1) 34228 [0.002] (1)
Donor
34058 [0.035] (0) 34109 [0.031] (0) 34122 [0.007] (1) 34182 [0.642] (1)

[help]


Entrance