information on T3E15    (22068..22307)

Direction: +

Frame: 3

ORF

    21978..22328  (Met: 22029 22290 22302)
VLPPVENLYTLGDEVVPMERLNDDDAPIHHSDNEAEPLDESYATQQFYFEEYSAPRQSKD
WKEIHKRLGFLQRWCKLQDKALAALNKKFNALQLKFSCSSSTTGMPPDMPFRRSGST

GenBank annotation

    None

BLASTX cluster

    10572..22307    cluster 6    44 hits for protein gene

BLASTN cluster

    None

GENSCAN

    20636..24730    gene model 10
    15757..12734    gene model 6
    Suboptimal exon

        22012..22195    Intr    Phase: 1    Score: 0.129
        22012..22328    Term    Phase: 1    Score: 0.271
        22029..22261    Init    Phase: 0    Score: 0.137
        22029..22328    Sngl    Phase: 0    Score: 0.150

Grail

    22029..22240    exon    Phase: 0    Score: 31

Exon-Intron boundary candidatates

Acceptor
22012 [0.016] (1) 22021 [0.001] (1) 22072 [0.003] (1) 22084 [0.002] (1)
22129 [0.017] (1) 22196 [0.007] (2) 22268 [0.002] (2) 22313 [0.004] (2)
Donor
22011 [0.007] (1) 22149 [0.003] (1)

[help]


Entrance