information on T3E15    (21044..21289)

Direction: +

Frame: 2

ORF

    20420..21427  (Met: 20636 20753 20825 20984 21153 21164 21194 21206 21371 21110 21148 21156)
PASIETLLSLCLLVPPHNRFGPPLQFLNSTTSSLHLPYQSNLKFLYLSLSLSLAFPLSIK
NSTKSIYFLHHSMTNRRTLLSRIRNRALSPLKRYPTPSSYVAARGLSEPSPMGSSRREQA
SFKIDHSESSQEEEVMQEEETFSSPVGNTRSRSKSSARKFSRNKADITRGKKPVGRRLEL
VDEDSKEEMASPKEADQTERGGDDDLESEKSATRNESYKLLKHNDFLGTR*SSRDHGETR
HL*M*YMFKQCSLNIHMFQPMEGYEEETIQFLSSVELFLYGESEDDRIRPDGNLGYLEFC
VYEVEYRLLIEHLELMYGFPSGKDTSHRFDKREL

GenBank annotation

    None

BLASTX cluster

    10572..22307    cluster 6    44 hits for protein gene

BLASTN cluster

    None

GENSCAN

    20636..24730    gene model 10
    12058..11609    gene model 5
    Suboptimal exon

        20636..21023    Init    Phase: 0    Score: 0.167
        20636..21109    Sngl    Phase: 0    Score: 0.472

Grail

    20636..21112    exon    Phase: 0    Score: 70
    21159..21430    exon    Phase: 1    Score: 53

Exon-Intron boundary candidatates

Acceptor
20647 [0.90N/0.374] (2) 20724 [0.031] (1) 20727 [0.174] (1) 20767 [0.014] (2)
20905 [0.107] (2) 20912 [0.007] (0) 20916 [0.002] (1) 21045 [0.006] (1)
21102 [0.54N/0.055] (1) 21159 [0.001] (1) 21176 [0.028] (0) 21181 [0.034] (2)
21203 [0.023] (0) 21276 [0.003] (1) 21292 [0.010] (2) 21339 [0.007] (1)
21366 [0.002] (1)
Donor
20697 [0.312] (2) 20715 [0.003] (2) 20876 [0.128] (1) 20949 [0.392] (2)
20959 [0.430] (0) 21023 [0.018] (1) 21213 [0.136] (2) 21323 [0.003] (1)
21327 [0.007] (2)

[help]


Entrance