information on T3E15    (17454..17621)

Direction: +

Frame: 3

ORF

    17295..18149  (Met: 17298 17520 17553 17631 17937)
LMNYKKPKQRHPVISKNQLLWINRNRPVDVQDPPNVDQPRNIGAGDAPRNHHQRQVILPP
PVQNNNFEIKSGLISMIQGNKFHGLPMEDPLDHLDRFDRFCGLTKINGVTEDMFKLRLFP
LSLGDKAHHWEKTLPPDFITSWDDCKKAFLAKFFSNARTTRLRNEIPGFTQKNNKTFCEA
WERVKSYTTQCPHHGFKKASLLSTLYRGALLKIRMLLDTASNENFLNKEVAEGWELVENL
AQSDGCYNEDYDRSVRETGGTEDKQSKDIKALNEKLDKLLLTRQK

GenBank annotation

    None

BLASTX cluster

    10572..22307    cluster 6    44 hits for protein gene

BLASTN cluster

    None

GENSCAN

    16288..18698    gene model 7
    Suboptimal exon

        17298..18056    Init    Phase: 0    Score: 0.750

Grail

    17298..18152    exon    Phase: 0    Score: 99

Exon-Intron boundary candidatates

Acceptor
17295 [0.001] (0) 17560 [0.001] (1) 17582 [0.002] (2) 17645 [0.048] (2)
17668 [0.003] (1) 17673 [0.110] (0) 17777 [0.002] (2) 17833 [0.001] (1)
17936 [0.004] (2) 17989 [0.002] (1) 18090 [0.002] (0) 18147 [0.002] (0)
Donor
17716 [0.005] (2) 17727 [0.053] (1)

[help]


Entrance