information on T3E15    (122514..122029)

Direction: -

Frame: 1

ORF

    122535..122152  (Met: 122424 122391 122313)
VKYSVISDAPRNHHQRQGIVSPPVQNNNFEIKSGLISMIQGNKFHGLPMEDPLDHLDSFD
RLCGLTKINGVTEDMFKLRLFPFSLGAKTHHWEKTLPPDSINSWDDCKKAFLAKFFSNAC
TARLRNEI

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN


    Suboptimal exon

        122424..122217    Init    Phase: 0    Score: 0.263

Grail

    122515..122149    exon    Phase: 2    Score: 86

Exon-Intron boundary candidatates

Acceptor
122271 [0.005] (0) 122276 [0.002] (1) 122299 [0.111] (2) 122353 [0.003] (2)
122515 [0.090] (2) 122524 [0.027] (2)
Donor
122217 [0.767] (1)

[help]


Entrance