information on T3E15    (122015..121839)

Direction: -

Frame: 2

ORF

    122162..121914  (Met: 122129 122006)
GTRSEVSHRKTMKHSVKLGRGLKATPLSAPITVLRRLHYLSTLYRGALPKIIMLLDTTSN
GNFLNKDVEKGWELVENLAQSDG

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN


    None

Grail

    122129..121911    exon    Phase: 0    Score: 65

Exon-Intron boundary candidatates

Acceptor
122136 [0.002] (2)
Donor
122067 [0.004] (0) 122148 [0.006] (0)

[help]


Entrance