information on T3E15    (121565..121131)

Direction: -

Frame: 2

ORF

    121598..121428  (Met:)
NQSKPFVQYNQGYAPKQQFNGGYQQQNPPPGFTQQPQQAPTAKDPEIKQLIQQIIHG

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN


    None

Grail

    121796..121599    exon    Phase: 0    Score: 50

Exon-Intron boundary candidatates

Acceptor
121520 [0.013] (0) 121523 [0.003] (0) 121544 [0.005] (0) 121574 [0.007] (0)
Donor
121565 [0.006] (1)

[help]


Entrance