information on T3E15    (120723..120577)

Direction: -

Frame: 1

ORF

    121038..120499  (Met: 120993 120810 120561)
KKFKTEKLRKDQNQEMISSASTQETYKKKVIQEKLDDPGSFTLPCSLGPLTFNRCLCDLG
ASVSLLPLSTAKRLRIMEYKFCNLALLLADDSVAHTNGLIENLPVKIVNVEIPTDFVVLD
VDEEGKDPLILGRPFLASAGAVIDVRNGKIDLNLEKGIKMRFDISKASRKSTTGVQNFGI

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN

    121412..120499    gene model 29
    Suboptimal exon

        120827..120499    Term    Phase: 1    Score: 0.411

Grail

    120827..120496    exon    Phase: 1    Score: 32
    121012..120496    exon    Phase: 2    Score: 51

Exon-Intron boundary candidatates

Acceptor
120540 [0.001] (0) 120544 [0.006] (2) 120569 [0.004] (1) 120601 [0.003] (2)
120623 [0.002] (1) 120640 [0.016] (2) 120644 [0.006] (1) 120665 [0.046] (1)
120668 [0.003] (1) 120674 [0.111] (1) 120695 [0.033] (1) 120737 [0.001] (1)
120773 [0.001] (1) 120820 [0.002] (2) 120827 [0.012] (1) 120877 [0.046] (2)
120896 [0.001] (1) 120982 [0.023] (2) 121002 [0.002] (0) 121012 [0.036] (2)
Donor
120570 [0.81N/0.014] (1) 120607 [0.027] (0) 120718 [0.004] (0) 120878 [0.023] (2)
120924 [0.007] (1)

[help]


Entrance