information on T3E15    (121050..120523)

Direction: -

Frame: 1

ORF

    121155..121042  (Met: 121137)
GQYDSRMGGGDSTQIAAPATKQFIWTIEHTTLLNTHHS

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN

    121412..120499    gene model 29

Grail


    None

Exon-Intron boundary candidatates

Acceptor
121149 [0.003] (0)
Donor
121151 [0.008] (2)

[help]


Entrance