information on T3E15    (120381..120253)

Direction: -

Frame: 1

ORF

    120495..120349  (Met: 120492 120390)
DMDVDEKTEVGTSPKVNYTSQLSKLKRTFDHKKRAMEELAQTEDPTEDD

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene

BLASTN cluster

    None

GENSCAN


    None

Grail

    120470..120346    exon    Phase: 1    Score: 74
    120827..120496    exon    Phase: 1    Score: 32
    121012..120496    exon    Phase: 2    Score: 51

Exon-Intron boundary candidatates

Acceptor
120464 [0.004] (1) 120470 [0.022] (1) 120495 [0.005] (0)
Donor

[help]


Entrance