information on T3E15    (118021..117659)

Direction: -

Frame: 3

ORF

    118276..117653  (Met: 117985 117931 117778)
GGLGYITFKVRDVEYTFDIRHLDTIFGFPSGEGICQDYDQEELKSLWKTIAGPKPFSPTK
SKSSSIGNPVIRYLHQCIANILFPKKATGFVSEKELCMIEQSLVFILRETKDGRKMAGDR
ADTSLSVVLLDHLLSYKEYAATIHRSGIRGSLCVSGLLTPILGTVGMEFGTPNVLPKFID
LDYLKGKDFLEKITPADRYLFKFNHTEL

GenBank annotation

    None

BLASTX cluster

    125454..117811    cluster 39    39 hits for protein gene
    117653..118021    cluster 37    1 hits for protein gene
    118268..118213    cluster 38    1 hits for protein gene

BLASTN cluster

    None

GENSCAN

    118848..101808    gene model 27
    Suboptimal exon

        118249..117781    Intr    Phase: 0    Score: 0.132

Grail

    117789..117650    exon    Phase: 1    Score: 38
    118441..118277    exon    Phase: 0    Score: 42

Exon-Intron boundary candidatates

Acceptor
117721 [0.001] (0) 117865 [0.001] (0) 117885 [0.019] (1) 117953 [0.019] (2)
118061 [0.004] (2) 118152 [0.001] (1) 118179 [0.002] (1) 118187 [0.001] (2)
Donor
117781 [0.037] (1) 117818 [0.004] (0) 118007 [0.015] (0) 118070 [0.005] (0)
118250 [0.669] (0) 118273 [0.007] (1)

[help]


Entrance