information on T27D20    (24067..24159)

Direction: +

Frame: 1

ORF

    24061..24381  (Met: 24133 24208 24346)
RKYYWDEGITELVKESFLVIAKKRMKGIVSQAKKSGEQPPWIRDTLWKQMWVHWNTEDAQ
LKSETTSNCRNSDRGGLGVHKHLAGQKSFVQVHQEMVRVFFPSKQFT

GenBank annotation

    22634..25080    T27D20.4

BLASTX cluster

    24142..24637    cluster 4    3 hits for protein gene

BLASTN cluster

    None

GENSCAN

    22634..25077    gene model 6

Grail

    24061..24348    exon    Phase: 0    Score: 89

Exon-Intron boundary candidatates

Acceptor
24061 [0.87N/0.173] (0) 24083 [0.017] (1) 24122 [0.368] (1) 24132 [0.001] (2)
24150 [0.002] (2) 24241 [0.002] (0) 24270 [0.001] (2) 24278 [0.006] (1)
24376 [0.004] (0)
Donor
24247 [0.015] (1) 24313 [0.93N/0.427] (1) 24348 [1.00N/0.835] (0)

[help]


Entrance