information on T25K17    (7473..7410)

Direction: -

Frame: 2

ORF

    7538..7374  (Met: 7460 7445)
VSYTYTKFNSSINSVSPFSLTSGLDYMINIVMKNHARNLLFCFVSDPCNLYELFS

GenBank annotation

    None

BLASTX cluster

    10392..6586    cluster 3    1 hits for protein gene

BLASTN cluster

    8284..6346    cluster 3    2 hits for EST

GENSCAN

    10392..6817    gene model 3

Grail


    None

Exon-Intron boundary candidatates

Acceptor
7473 [0.071] (2) 7538 [0.014] (0)
Donor
7410 [0.076] (0) 7539 [0.017] (0)

[help]


Entrance