information on T10I14    (38208..37430)

Direction: -

Frame: 2

ORF

    38452..37391  (Met: 38275 38182 38032 37999 37861)
WQYLFSFTHVYLSHSGFFVLFCFVLFCLQCVIIFFGVVDAGDLLFRLITPERFIRIWQRM
DRINGLSDDIICHILSLLSFKEATSTSVLSMRWRYLFAFRPNLCLDDQEVGGGDSFIDFV
DRVLVVTGNFPIRRISIKCRMSIDTGHVTRWMVDVLEHGVSYLDIDIISEDDIGFVPLEI
FTCKTLVELKLARGFYAMVPDYVSLPSLKTLFLSSIWFCNRDCCPLGRLLSACPVLEELT
IIGGCWQHIEFCRTVSSSTLKKLTITSSFHYEYWGITIDTPSLAYLEYSDLVPRHFPFVN
LESLVEAKLALDLCSDSNPTNLIKGLRNVEVLELSSGYTSQVKIDLPSFSFSVR

GenBank annotation

    39162..36812    T10I14.110

BLASTX cluster

    38293..36914    cluster 7    14 hits for protein gene

BLASTN cluster

    None

GENSCAN

    39162..36815    gene model 9

Grail


    None

Exon-Intron boundary candidatates

Acceptor
37391 [0.001] (2) 37429 [0.022] (0) 37502 [0.002] (2) 37769 [0.024] (2)
37790 [0.86N/0.793] (2) 37811 [0.002] (2) 38070 [0.299] (1) 38087 [0.009] (2)
38136 [0.006] (1) 38153 [0.037] (2) 38206 [0.003] (0) 38208 [0.005] (1)
38288 [0.003] (2) 38297 [0.001] (2) 38315 [0.291] (2) 38328 [0.65N/0.001] (1)
38365 [0.905] (0) 38435 [0.004] (2) 38446 [0.029] (0)
Donor
37397 [0.011] (0) 37430 [0.97N/0.480] (0) 37435 [0.005] (1) 37444 [0.006] (1)
37859 [0.030] (0) 37978 [0.038] (1) 37997 [0.005] (0) 38071 [0.828] (1)
38260 [0.015] (1) 38298 [0.036] (2)

[help]


Entrance