information on F19B15    (36799..36635)

Direction: -

Frame: 3

ORF

    36865..36398  (Met: 36820 36763 36748)
SLNASKVCPQLYLKKMSVSVAAEHDYIGLSEFPTMEATTMSDKTKTRDNNNGLNFKATEL
RLGLPGSESPERVDSRFLALNKSSCPVSGAKRVFSDAINDSNKWVFSPGSTTATGDVGSG
SGPRTSVVKDGKSTTFTKPAVPVKEKKSSATAPASK

GenBank annotation

    36820..35272    F19B15.110

BLASTX cluster

    36820..35614    cluster 6    3 hits for protein gene

BLASTN cluster

    36729..36399    cluster 12    1 hits for EST

GENSCAN

    36763..35275    gene model 9
    Suboptimal exon

        36820..36399    Init    Phase: 0    Score: 0.290

Grail

    36820..36395    exon    Phase: 0    Score: 99

Exon-Intron boundary candidatates

Acceptor
36600 [0.022] (1) 36614 [0.001] (2) 36697 [0.029] (0) 36774 [0.065] (1)
36783 [0.134] (1) 36798 [0.96N/0.057] (1) 36801 [0.342] (1) 36804 [0.96N/0.107] (1)
Donor
36399 [1.00N/0.995] (2) 36601 [0.019] (1) 36606 [0.006] (2) 36784 [0.017] (1)

[help]


Entrance