information on F17I23    (59450..59253)

Direction: -

Frame: 2

ORF

    59483..59229  (Met: 59438 59267)
FEFDEIVFLVTGAAQMYENGVLAYVDVKFLADVHIRAFEDVSACGRYFCFNQIVNTEEEA
LKLVESLSPLIPMPPRYSFLFNSIL

GenBank annotation

    None

BLASTX cluster

    61327..59087    cluster 9    1 hits for protein gene

BLASTN cluster

    61047..59042    cluster 10    6 hits for EST

GENSCAN

    63417..59087    gene model 12
    44574..55997    gene model 10
    Suboptimal exon

        59464..59257    Intr    Phase: 1    Score: 0.103

Grail

    59449..59226    exon    Phase: 1    Score: 89

Exon-Intron boundary candidatates

Acceptor
59356 [0.013] (1) 59376 [0.001] (2) 59392 [0.020] (1) 59407 [0.014] (1)
59449 [0.94N/0.968] (1) 59464 [0.007] (1)
Donor
59230 [0.007] (2) 59257 [1.00N/0.913] (2) 59426 [0.018] (1) 59437 [0.010] (2)

[help]


Entrance