information on AP22    (41261..41172)

Direction: -

Frame: 2

ORF

    41261..41163  (Met:)
NPVELEGIKNAHVRDGAAVVQYLVWLDNQVLNK

GenBank annotation

    42695..39437    C7A10.600

BLASTX cluster

    42695..39440    cluster 10    3 hits for protein gene

BLASTN cluster

    None

GENSCAN

    44775..39414    gene model 9

Grail

    41261..41160    exon    Phase: 0    Score: 90

Exon-Intron boundary candidatates

Acceptor
41242 [0.017] (1) 41261 [0.96N/0.169] (0)
Donor
41175 [1.00N/0.874] (0) 41200 [0.005] (2)

[help]


Entrance