information on AP22    (164349..164420)

Direction: +

Frame: 3

ORF

    164298..164768  (Met: 164439 164691 164700)
KKSIIHYLLLKPPHFSNVISGSHTIGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQ
RCPKSGGDQILSVLDIISAASFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAED
QGEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINS

GenBank annotation

    163502..164771    C7A10.930

BLASTX cluster

    163565..164798    cluster 37    21 hits for protein gene

BLASTN cluster

    163504..164967    cluster 32    2 hits for EST

GENSCAN

    163502..165698    gene model 32
    Suboptimal exon

        164359..164768    Term    Phase: 1    Score: 0.778

Grail

    164359..164771    exon    Phase: 1    Score: 59

Exon-Intron boundary candidatates

Acceptor
164359 [0.87N/0.607] (1) 164363 [0.005] (2) 164399 [0.021] (2) 164403 [0.029] (0)
164612 [0.006] (2) 164615 [0.039] (2) 164653 [0.002] (1) 164725 [0.124] (1)
164756 [0.005] (2)
Donor
164358 [0.019] (1) 164644 [0.049] (2) 164724 [0.032] (1)

[help]


Entrance