information on AP22    (163589..163726)

Direction: +

Frame: 2

ORF

    163337..163729  (Met: 163502 163679)
LFAFPLIIYLHPNLANTNSVSYSSKSFPINTFFFPSYFISLTTKSSHFLIFLLKVMARLT
SFLLLLSLICFVPLCLCDKSYGGKLFPGYYAHSCPQVNEIVRSVVAKAVARETRMAASLL
RLHFHDCFVQV

GenBank annotation

    163502..164771    C7A10.930

BLASTX cluster

    163565..164798    cluster 37    21 hits for protein gene

BLASTN cluster

    163504..164967    cluster 32    2 hits for EST

GENSCAN

    163502..165698    gene model 32

Grail

    163502..163726    exon    Phase: 0    Score: 86

Exon-Intron boundary candidatates

Acceptor
163380 [0.003] (1) 163574 [0.001] (0) 163653 [0.001] (1) 163727 [0.002] (0)
Donor
163598 [0.030] (1) 163636 [0.008] (0) 163676 [0.85N/0.067] (1) 163726 [0.92N/0.528] (0)

[help]


Entrance