information on AP22    (148471..148298)

Direction: -

Frame: 3

ORF

    148507..148298  (Met: 148486 148474)
TLSPFLDMTRCMQALKEDSLLVVSSKRSFLDKCRLPVGIKLYVSAGHSESDLLKASESLK
RLASELLLKS

GenBank annotation

    150821..148295    C7A10.880

BLASTX cluster

    150821..148298    cluster 32    1 hits for protein gene

BLASTN cluster

    148672..148305    cluster 29    2 hits for EST

GENSCAN

    150821..139971    gene model 29
    Suboptimal exon

        148507..148298    Term    Phase: 0    Score: 0.864

Grail

    148474..148295    exon    Phase: 0    Score: 72

Exon-Intron boundary candidatates

Acceptor
148374 [0.002] (1) 148468 [0.010] (0) 148478 [0.007] (2)
Donor
148442 [0.032] (0)

[help]


Entrance