information on AP22    (10522..10848)

Direction: +

Frame: 1

ORF

    10480..10848  (Met: 10579)
GNIKKCFVALCISVGYPNLRPEVEEGICQVLAHMWLESETYAGSTLVDIASSSSSAVVSA
SSKKGERSDFEKKLGEFFKHQIESDSSSAYGDGFRQGNQAVLKHGLRRTLDHIRLTGTFP
KWI

GenBank annotation

    8165..10851    C7A10.500

BLASTX cluster

    8165..10848    cluster 1    1 hits for protein gene

BLASTN cluster

    18385..10568    cluster 2    2 hits for EST

GENSCAN

    1560..15852    gene model 1
    Suboptimal exon

        10523..10768    Intr    Phase: 1    Score: 0.256
        10523..10848    Term    Phase: 1    Score: 0.237

Grail

    10523..10828    exon    Phase: 1    Score: 89

Exon-Intron boundary candidatates

Acceptor
10523 [0.95N/0.406] (1) 10539 [0.007] (2) 10544 [0.019] (1) 10622 [0.017] (1)
10658 [0.001] (1) 10764 [0.057] (2)
Donor
10672 [0.722] (1) 10679 [0.086] (2) 10702 [0.077] (1) 10768 [0.360] (1)
10792 [0.006] (1) 10828 [1.00N/0.670] (1)

[help]


Entrance