information on AP22    (128516..128756)

Direction: +

Frame: 3

ORF

    128442..128768  (Met: 128442 128760)
MNVFFEALFDIPQGSLKQVLPLLYSLGGFTALSVAVGLPEQVTGVALLNSAGQFAAESRK
REEADETVITKFIVKPLKEIFQRVVLGFLFWQAKQPSRIESVLKSVMSY

GenBank annotation

    127649..129299    C7A10.830

BLASTX cluster

    127649..129296    cluster 29    1 hits for protein gene

BLASTN cluster

    None

GENSCAN

    127799..139538    gene model 28
    Suboptimal exon

        128516..128756    Intr    Phase: 2    Score: 0.185

Grail

    128542..128756    exon    Phase: 1    Score: 62

Exon-Intron boundary candidatates

Acceptor
128461 [0.002] (1) 128482 [0.001] (1) 128516 [0.87N/0.237] (2) 128542 [0.011] (1)
128662 [0.001] (1)
Donor
128642 [0.005] (0) 128756 [0.96N/0.050] (0)

[help]


Entrance