information on AP22    (114479..114369)

Direction: -

Frame: 2

ORF

    114614..114372  (Met: 114578 114572 114527)
RSKATLRASSLGMSMTLSQGVIHIPITVQMETTTESIKGTPKGKQNITTIIHKKAFINNR
HALSSFLCVSSCFTRPEKKKI

GenBank annotation

    114757..114369    C7A10.790

BLASTX cluster

    114724..108771    cluster 26    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    114678..108759    gene model 24

Grail

    114578..114369    exon    Phase: 0    Score: 50

Exon-Intron boundary candidatates

Acceptor
114390 [0.254] (2) 114435 [0.007] (2) 114557 [0.006] (0)
Donor
114488 [1.00N/0.931] (1) 114611 [0.221] (1)

[help]


Entrance