information on AP22    (111459..111181)

Direction: -

Frame: 1

ORF

    111492..111142  (Met: 111459 111405 111399)
IRVNLFFLSKSMAASRLCSAAAIAAAFTSMSMSQNRAYADSSRFRFPFFSSSPSPPPSDS
PANQSSSKSKAEPDEPKGSGFDPEALERAAKALRDINSSPHSKQVTLHIYLGNEIRI

GenBank annotation

    111459..108756    C7A10.780

BLASTX cluster

    114724..108771    cluster 26    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    114678..108759    gene model 24
    75701..76936    gene model 14
    Suboptimal exon

        111459..111181    Init    Phase: 0    Score: 0.810

Grail

    111445..111139    exon    Phase: 2    Score: 87

Exon-Intron boundary candidatates

Acceptor
111158 [0.002] (1) 111180 [0.004] (0) 111199 [0.001] (2) 111278 [0.010] (1)
111317 [0.022] (1) 111445 [0.94N/0.085] (2)
Donor
111181 [1.00N/0.460] (0) 111387 [0.004] (1) 111487 [0.010] (0)

[help]


Entrance