information on AP22    (150821.. 150716)

Direction: -

Frame: 2

ORF

    150833..150693  (Met: 150821 150800 150770)
SKLAMASNLVEMFNAALNWVTMILESPSARVVLFGVPIRGIDLKKQL

GenBank annotation

    150821..148295    C7A10.880

BLASTX cluster

    150821..148298    cluster 32    1 hits for protein gene

BLASTN cluster

    None

GENSCAN

    150821..139971    gene model 29

Grail

    150821..150690    exon    Phase: 0    Score: 85

Exon-Intron boundary candidatates

Acceptor
150744 [0.001] (2) 150748 [0.002] (1)
Donor
150716 [1.00N/0.287] (1)

[help]


Entrance