information on AP22    ( 138026..138096)

Direction: +

Frame: 1

ORF

    138025..138177  (Met: 138139 138142)
GTEGESPQRYTSRLERHQRTADRVVTDASILVLKSTPLMMLVNGHIEFLTG

GenBank annotation

    133984..139541    C7A10.840

BLASTX cluster

    133984..144113    cluster 30    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    127799..139538    gene model 28

Grail


    None

Exon-Intron boundary candidatates

Acceptor
138026 [0.93N/0.584] (1) 138035 [0.359] (1) 138051 [0.006] (2) 138176 [0.96N/0.877] (1)
Donor
138050 [0.015] (2) 138096 [0.96N/0.198] (0)

[help]


Entrance