information on AP22    (110827.. 110717)

Direction: -

Frame: 3

ORF

    110836..110699  (Met:)
NGQGRQQKLAEDQRNLLQTQAQTKAQNLRYEDELARKRQQVILFFS

GenBank annotation

    111459..108756    C7A10.780

BLASTX cluster

    114724..108771    cluster 26    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    114678..108759    gene model 24

Grail

    110827..110696    exon    Phase: 0    Score: 88

Exon-Intron boundary candidatates

Acceptor
110776 [0.031] (0) 110782 [0.104] (0) 110815 [0.005] (0) 110822 [0.051] (2)
110827 [0.96N/0.858] (0)
Donor
110717 [1.00N/0.980] (0)

[help]


Entrance