information on AP22    (109941.. 109647)

Direction: -

Frame: 2

ORF

    110033..109590  (Met: 110000 109940 109904 109712 109709 109676 109598)
ILLSFSNVIYFMNLFVFDSEGARVTWGYINRMLGQPSLIRESSMRRFPWTGSVSQFKNRI
SGAAAASAAEGKKPLDNVILHTSLKKRIERLARATANTKSHQAPFRNMMFYGPPGTGKTM
VAREIARKSVSYYQNYGSSFVSTVFMSS

GenBank annotation

    111459..108756    C7A10.780

BLASTX cluster

    114724..108771    cluster 26    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    114678..108759    gene model 24

Grail

    110000..109587    exon    Phase: 0    Score: 91

Exon-Intron boundary candidatates

Acceptor
109747 [0.002] (1) 109755 [0.001] (2) 109778 [0.005] (0) 109849 [0.014] (1)
109857 [0.842] (2) 109862 [0.003] (0) 109882 [0.148] (1) 109896 [0.012] (2)
109941 [0.82N/0.199] (2) 109972 [0.94N/0.169] (1) 109977 [0.973] (2)
Donor
109625 [0.104] (1) 109647 [1.00N/0.599] (0) 109685 [0.85N/0.105] (1) 109691 [0.005] (1)
109803 [0.326] (0) 110013 [0.006] (0)

[help]


Entrance