information on AP22    (174153..174670)

Direction: +

Frame: 2

ORF

    174101..174670  (Met: 174221 174230 174245 174614)
NLDVTCLIQKRQLCILIGFCGETEEEHQETLSLVRAVGYDMAYMFAYSMREKTHAHRNYT
DDVPEEVKQRRLTELIDAFRETTGPCYDSQVGSTQLVLVEGPNKRAPETELIGKTDKGHR
VSFVTKPLFDKACLLDGDDLKRNPGIGDFVEVQIEKSTRASLFGEALAISKMSLFHDVGV
VDAVVASCAS

GenBank annotation

    172642..174673    C7A10.970

BLASTX cluster

    172878..174628    cluster 41    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    173079..174670    gene model 35

Grail

    174153..174668    exon    Phase: 1    Score: 87

Exon-Intron boundary candidatates

Acceptor
174131 [0.001] (0) 174133 [0.61N] (2) 174153 [1.00N/0.415] (1) 174210 [0.005] (1)
174244 [0.155] (2) 174282 [0.003] (1) 174321 [0.006] (1) 174371 [0.113] (0)
174375 [0.003] (1) 174386 [0.003] (0) 174402 [0.004] (1) 174554 [0.003] (0)
174560 [0.206] (0) 174564 [0.004] (1)
Donor
174199 [0.021] (0) 174298 [0.020] (0) 174350 [0.714] (1) 174370 [0.482] (0)
174608 [0.004] (1)

[help]


Entrance