information on AP22    (114678..114611)

Direction: -

Frame: 1

ORF

    114738..114610  (Met: 114678)
ALALLGHVRRTNYLKGRWLHMTRTLLTVGITLQEPLAANQLKK

GenBank annotation

    114757..114369    C7A10.790

BLASTX cluster

    114724..108771    cluster 26    2 hits for protein gene

BLASTN cluster

    None

GENSCAN

    114678..108759    gene model 24

Grail


    None

Exon-Intron boundary candidatates

Acceptor
114670 [0.066] (2) 114692 [0.005] (1) 114731 [0.001] (1)
Donor
114611 [0.221] (2) 114718 [0.076] (0)

[help]


Entrance