Jatropha Genome Database

JcCA0154771.10
Show Alignment:  
BLASTP 2.2.23 [Feb-03-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= JcCA0154771.10 - phase: 0 /pseudo
         (340 letters)

Database: TAIR9_pep 
           33,410 sequences; 13,434,913 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G27230.1 | Symbols:  | INVOLVED IN: biological_process unknow...    71   1e-12

>AT5G27230.1 | Symbols:  | INVOLVED IN: biological_process
          unknown; EXPRESSED IN: seed; EXPRESSED DURING: E
          expanded cotyledon stage; CONTAINS InterPro DOMAIN/s:
          Frigida-like (InterPro:IPR012474); BEST Arabidopsis
          thaliana protein match is: hydroxyproline-rich
          glycoprotein family protein (TAIR:AT3G22440.1); Has
          7968 Blast hits to 5791 proteins in 512 species: Archae
          - 158; Bacteria - 808; Metazoa - 2750; Fungi - 421;
          Plants - 1028; Viruses - 76; Other Eukaryotes - 2727
          (source: NCBI BLink). | chr5:9584255-9587838 FORWARD
          Length = 948

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 52/67 (77%)

Query: 3  DKISSELKLTELHKQNFRQTLDQLHDSASSILLLTHQWKDIEDHLDSTHLIIEKCAKELH 62
          +K++S L+L ++ K+NFR+TL+ L + A S+LLLT QWK+IE + DST  ++E+ AKEL 
Sbjct: 2  EKVTSGLELVDISKRNFRKTLESLQEGAHSLLLLTIQWKEIESYFDSTRSVLEERAKELE 61

Query: 63 SLQQDIK 69
          +L++ IK
Sbjct: 62 ALEESIK 68