hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18413903/chunk_1/iprscan-20080502-18413903.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1996 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00887.9.fs Acyl CoA binding protein 50.6 7.6e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00887.9.fs 1/1 13 43 .. 59 89 .] 50.6 7.6e-14 Alignments of top-scoring domains: PF00887.9.fs: domain 1 of 1, from 13 to 43: score 50.6, E = 7.6e-14 *->WDAWnelkGmSkeeAmkaYIakVeeLiakya<-* WDAW++l++m+keeAm+aY+++++++i++++ KIAA1996 13 WDAWSSLGDMTKEEAMIAYVEEMKKIIETMP 43 //