hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18232611/chunk_1/iprscan-20080502-18232611.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1985 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 52.0 7.7e-11 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/4 195 228 .. 1 34 [] 7.4 73 SM00028 2/4 503 536 .. 1 34 [] 17.0 2.7 SM00028 3/4 711 744 .. 1 34 [] 4.2 1.7e+02 SM00028 4/4 833 866 .. 1 34 [] 23.4 0.031 Alignments of top-scoring domains: SM00028: domain 1 of 4, from 195 to 228: score 7.4, E = 73 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a+ ++ lG + ++ ++ +A y+e+A+ + KIAA1985 195 ARLCFLLGRLSIRKVKLSQARVYFEEAIHILNGA 228 SM00028: domain 2 of 4, from 503 to 536: score 17.0, E = 2.7 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +++ lG+a+ g+ + A + y +AL + + KIAA1985 503 GVIYNLLGLALQGEGRVNRAAKSYLRALNRAQEV 536 SM00028: domain 3 of 4, from 711 to 744: score 4.2, E = 1.7e+02 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* aea++ G +++++ + + + +++ A++ + + KIAA1985 711 AEAWLGAGRLHYLMQEDELVELCLQAAIQTALKS 744 SM00028: domain 4 of 4, from 833 to 866: score 23.4, E = 0.031 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a+ +l+ +y++l y++A+++y k L+l P KIAA1985 833 LVAFHRLATVYYSLHMYEMAEDCYLKTLSLCPPW 866 //