hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18232611/chunk_1/iprscan-20080502-18232611.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1985 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07719.7.ls Tetratricopeptide repeat 61.3 2.9e-15 6 PF07719.7.fs Tetratricopeptide repeat 52.7 9.7e-14 8 PF00515.18.fs Tetratricopeptide repeat 43.3 2.6e-11 6 PF00515.18.ls Tetratricopeptide repeat 37.9 3.2e-08 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00515.18.fs 3/6 503 536 .. 1 34 [] 10.6 0.052 PF00515.18.ls 2/4 503 536 .. 1 34 [] 12.6 0.16 PF00515.18.fs 5/6 833 864 .. 1 32 [. 21.4 4.4e-05 PF00515.18.ls 4/4 833 866 .. 1 34 [] 17.7 0.038 Alignments of top-scoring domains: PF00515.18.fs: domain 3 of 6, from 503 to 536: score 10.6, E = 0.052 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* +y+ lG+a+ g+ + A + y +AL + KIAA1985 503 GVIYNLLGLALQGEGRVNRAAKSYLRALNRAQEV 536 PF00515.18.ls: domain 2 of 4, from 503 to 536: score 12.6, E = 0.16 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* +y+ lG+a+ g+ + A + y +AL + KIAA1985 503 GVIYNLLGLALQGEGRVNRAAKSYLRALNRAQEV 536 PF00515.18.fs: domain 5 of 6, from 833 to 864: score 21.4, E = 4.4e-05 *->aeayynlGnaylklgkydeAieayekALeldP<-* a+ +l+ +y++l y+ A+++y k L+l P KIAA1985 833 LVAFHRLATVYYSLHMYEMAEDCYLKTLSLCP 864 PF00515.18.ls: domain 4 of 4, from 833 to 866: score 17.7, E = 0.038 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* a+ +l+ +y++l y+ A+++y k L+l P KIAA1985 833 LVAFHRLATVYYSLHMYEMAEDCYLKTLSLCPPW 866 //