hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18144382/chunk_1/iprscan-20080502-18144382.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1980 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 62.9 4e-14 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/3 197 230 .. 1 34 [] 18.7 0.83 SM00028 2/3 231 264 .. 1 34 [] 26.9 0.0028 SM00028 3/3 272 305 .. 1 34 [] 17.3 2.1 Alignments of top-scoring domains: SM00028: domain 1 of 3, from 197 to 230: score 18.7, E = 0.83 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a + +G+ y+k g++ +A++ y+kALe+d +n KIAA1980 197 ALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQN 230 SM00028: domain 2 of 3, from 231 to 264: score 26.9, E = 0.0028 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +eal +G +y +g +++Aie++e ALe P++ KIAA1980 231 VEALVARGALYATKGSLNKAIEDFELALENCPTH 264 SM00028: domain 3 of 3, from 272 to 305: score 17.3, E = 2.1 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* ++l +G ++ +++ A+ yy+kAL+ld+++ KIAA1980 272 CQTLVERGGQLEEEEKFLNAESYYKKALALDETF 305 //