hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18112242/chunk_1/iprscan-20080502-18112242.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1978 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 95.3 5.9e-26 3 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 77.0 5.5e-20 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 2/3 55 126 .. 1 74 [] 58.8 1e-15 PF00076.12.ls 1/2 55 126 .. 1 74 [] 60.7 4.3e-15 PF00076.12.fs 3/3 178 215 .. 37 74 .] 25.8 1.8e-06 Alignments of top-scoring domains: PF00076.12.fs: domain 2 of 3, from 55 to 126: score 58.8, E = 1e-15 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l V NLpp++t+++ ++l ++fG+ e++ +v+ tg+skG++F KIAA1978 55 LCVANLPPSLTQQQFEELVRPFGSLERCFLVYS--ERTGQSKGYGFA 99 eFedeedAekAldalnGkelggrelrv<-* e+ ++++A++A++ l Gk lg r+l+v KIAA1978 100 EYMKKDSAARAKSDLLGKPLGPRTLYV 126 PF00076.12.ls: domain 1 of 2, from 55 to 126: score 60.7, E = 4.3e-15 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l V NLpp++t+++ ++l ++fG+ e++ +v+ tg+skG++F KIAA1978 55 LCVANLPPSLTQQQFEELVRPFGSLERCFLVYS--ERTGQSKGYGFA 99 eFedeedAekAldalnGkelggrelrv<-* e+ ++++A++A++ l Gk lg r+l+v KIAA1978 100 EYMKKDSAARAKSDLLGKPLGPRTLYV 126 PF00076.12.fs: domain 3 of 3, from 178 to 215: score 25.8, E = 1.8e-06 *->etgrskGfaFVeFedeedAekAldalnGkelggrelrv<-* + g+ kGfa e+e+ e Ae+A ++ +G lgg lrv KIAA1978 178 QDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRV 215 //