hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-16392532/chunk_1/iprscan-20080502-16392532.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1923 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00591 68.9 6.5e-16 1 SM00320 57.5 1.7e-12 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00320 1/2 38 78 .. 1 46 [] 40.1 3e-07 SM00320 2/2 129 173 .. 1 46 [] 17.4 0.86 SM00591 1/1 251 352 .. 1 128 [] 68.9 6.5e-16 Alignments of top-scoring domains: SM00320: domain 1 of 2, from 38 to 78: score 40.1, E = 3e-07 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW +++ + l +H + +++++++pd+ +++la++s+D+++++W KIAA1923 38 PsTAVEYLAAHLS--KIHGLDWHPDS-----EHILATSSqDNSVKFW 77 d<-* d KIAA1923 78 D 78 SM00320: domain 2 of 2, from 129 to 173: score 17.4, E = 0.86 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW +++++t+ gH++ V+ ++ ++++++ +l++ s+D t+r+W KIAA1923 129 LnTPVHTFVGHDD--VVLEFQWRKQ-KEGSKDYQLVTWSrDQTLRMW 172 d<-* KIAA1923 173 R 173 SM00591: domain 1 of 1, from 251 to 352: score 68.9, E = 6.5e-16 *->eEleaLesIYped.fevieedaspnvsnreitiklspeedeesitsk +E + + +++++e+ ++d+s + + +++s ++ KIAA1923 251 QEFSLINVQIRNVnVEMDAADRS-----CTVSVHCSNHR-------- 284 snvlegedqyvsltLqvklPenYPd.eaPpifllssekglsdeqlkkaeL +++ vk+P++YP+++aP ++++++ +++ +++ a+L KIAA1923 285 ------------VKMLVKFPAQYPNnSAPSFQFINPT-TITSTMK--AKL 319 lkkLqeiaeenellGevmifelveklqeflseh<-* lk+L+++a + +++G+ ++ ++++ l ++l+++ KIAA1923 320 LKILKDTALQKVKRGQSCLEPCLRQLVSCLESF 352 //