hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-16274831/chunk_1/iprscan-20080502-16274831.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1916 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF03736.7.ls EPTP domain 190.3 4.2e-54 3 PF03736.7.fs EPTP domain 185.1 1.5e-52 3 PF00560.23.ls Leucine Rich Repeat 51.8 2.1e-12 5 PF00560.23.fs Leucine Rich Repeat 42.5 1.4e-10 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00560.23.ls 2/5 83 105 .. 1 24 [] 12.1 1.5 PF00560.23.ls 3/5 107 129 .. 1 24 [] 14.5 0.35 PF00560.23.fs 3/5 107 129 .. 1 24 [] 12.7 0.021 PF00560.23.fs 4/5 131 153 .. 1 24 [] 13.9 0.0092 PF00560.23.ls 4/5 131 153 .. 1 24 [] 15.8 0.14 PF03736.7.fs 1/3 217 257 .. 1 44 [] 88.7 1.7e-23 PF03736.7.ls 1/3 217 257 .. 1 44 [] 90.6 4.5e-24 PF03736.7.ls 2/3 405 446 .. 1 44 [] 91.2 3e-24 PF03736.7.fs 2/3 405 446 .. 1 44 [] 89.3 1.1e-23 Alignments of top-scoring domains: PF00560.23.ls: domain 2 of 5, from 83 to 105: score 12.1, E = 1.5 *->nLeeLdLsgCNpsltgslpss.l.nl<-* +L+ L L++ N s+t + ++++ +l KIAA1916 83 SLQLLLLNS-N-SFT-IIRDDaFaGL 105 PF00560.23.ls: domain 3 of 5, from 107 to 129: score 14.5, E = 0.35 *->nLeeLdLsgCNpsltgslpss.l.nl<-* +Le+L ++g N +++ +++ +++++l KIAA1916 107 HLEYLFIEG-N-KIE-TISRNaFrGL 129 PF00560.23.fs: domain 3 of 5, from 107 to 129: score 12.7, E = 0.021 *->nLeeLdLsgCNpsltgslpss.l.nl<-* +Le+L ++g N +++ +++ +++++l KIAA1916 107 HLEYLFIEG-N-KIE-TISRNaFrGL 129 PF00560.23.fs: domain 4 of 5, from 131 to 153: score 13.9, E = 0.0092 *->nLeeLdLsgCNpsltgslpss.l.nl<-* L++L+L + N ++ + lp + +++l KIAA1916 131 DLTHLSLAN-N-HI-KALPRDvFsDL 153 PF00560.23.ls: domain 4 of 5, from 131 to 153: score 15.8, E = 0.14 *->nLeeLdLsgCNpsltgslpss.l.nl<-* L++L+L + N ++ + lp + +++l KIAA1916 131 DLTHLSLAN-N-HI-KALPRDvFsDL 153 PF03736.7.fs: domain 1 of 3, from 217 to 257: score 88.7, E = 1.7e-23 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* Fv+hq+lP +++++v++F++++DvY+a+aqp+++ +++vl+Wd KIAA1916 217 FVVHQTLP--YQSVSVDTFNSKNDVYVAIAQPSME-NCMVLEWD 257 PF03736.7.ls: domain 1 of 3, from 217 to 257: score 90.6, E = 4.5e-24 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* Fv+hq+lP +++++v++F++++DvY+a+aqp+++ +++vl+Wd KIAA1916 217 FVVHQTLP--YQSVSVDTFNSKNDVYVAIAQPSME-NCMVLEWD 257 PF03736.7.ls: domain 2 of 3, from 405 to 446: score 91.2, E = 3e-24 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* Fv+h+d+Pn+edvlavk+F++++++YL+L+++ig dS+v+rW+ KIAA1916 405 FVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIG--DSRVMRWN 446 PF03736.7.fs: domain 2 of 3, from 405 to 446: score 89.3, E = 1.1e-23 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* Fv+h+d+Pn+edvlavk+F++++++YL+L+++ig dS+v+rW+ KIAA1916 405 FVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIG--DSRVMRWN 446 //